Protein Info for B158DRAFT_1607 in Kangiella aquimarina DSM 16071

Annotation: Na+/phosphate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 113 to 129 (17 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 277 to 304 (28 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 14 to 155 (142 residues), 114.5 bits, see alignment E=2e-37 amino acids 172 to 252 (81 residues), 46.5 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 79% identity to kko:Kkor_1366)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>B158DRAFT_1607 Na+/phosphate symporter (Kangiella aquimarina DSM 16071)
MSLEWLNFLAGVGIFLWGMSLIESSLAKLASGKLNYYLTSWTKTSISAVATGAVCTAVVQ
SSSLVTIIVLALASSKLLNLKQAVGVIFGANLGTTATGWLVTYLGFKFSLGDFAIYFIGF
AALLRVFFAKNTNQVAFYTLFISIGLILFSLDLIKSGTIALSHNFDITNLQSQSPFIFVA
VGILLATLVQSSSAVMMMNLSAAHAGLISVEHAFAIVVGADIGTTSTAILGSIKGAKIKK
QLALAHVVFNLTNATVAVFLILPFIKTIFEFLNITDVLISIVAFHSIINLIGILVYLTLF
NYFVSFLSLRFSDSLSPIESRLSLIPVNMPPVAIERFRSETVSFINKVSQFNQKCLSTDY
VNPEHYFELKKMEGLFIKFSRQLSERPLTQEQTQALYNLLAAIRDGIYSAKLLKDLLADL
EQPDLSESYHDKSMFPIFNQSKAFYEDSRHLFDQKVDLSFKDFTKNWYEKLYHEFKTSEA
NLLSSQISQNISVDIISTLLNLNKSLYKSCKYYMQALESIDKTIKETNHEN