Protein Info for B158DRAFT_1583 in Kangiella aquimarina DSM 16071

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF05231: MASE1" amino acids 33 to 302 (270 residues), 37 bits, see alignment E=2.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 321 to 482 (162 residues), 165 bits, see alignment E=6.4e-53 PF00990: GGDEF" amino acids 322 to 480 (159 residues), 153.4 bits, see alignment E=4.7e-49

Best Hits

KEGG orthology group: None (inferred from 84% identity to kko:Kkor_1389)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>B158DRAFT_1583 diguanylate cyclase (Kangiella aquimarina DSM 16071)
MLIRSYLTQIHQKGHKEFRVGKRSTSLYSIIFLLLSAVAYYASARFGMSLFTLFPSNISL
LWLPSGIGFLMCLRWGWKAVPFIIIAAYYVNLPGMSVSTVEAAKLHTLISAIADGLESYI
AMLLFAKYLPRGVINPKTLSKFIWWVCIIPPLMTATVITANLWVGGYLVSHQLEEFFVSL
LLANSLGMLMVYQLYNSLKLDPIQFKKPSIGLCLSMVLIGFIFLLGIWRYPAIIYLILPV
LVIMSFELRLLTVASISTLTFISLITATHFDLGPFVAMTDQATAFELMAFTFACAITVFG
LSLQQYQMRLAKESGERWKLAAEHDVLTGLPNRRAFMPALTKEHHRSVRLGHTYCAVIWD
IDDFKNINDTYGHDFGDYVLVRLAQVMRSSCRDIDYYARIGGEEFAVLLPETDMESGKNA
MERFRNEVAEEVFTAPDGTRHSVTISIGIACLASRGITETELLAEADKALYKSKEQGKNR
TTAYCHPNKN