Protein Info for B158DRAFT_1578 in Kangiella aquimarina DSM 16071

Annotation: signal peptide peptidase SppA, 67K type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 25 to 618 (594 residues), 530.9 bits, see alignment E=3.6e-163 PF01343: Peptidase_S49" amino acids 138 to 284 (147 residues), 94.7 bits, see alignment E=5.8e-31 amino acids 394 to 545 (152 residues), 156.3 bits, see alignment E=6e-50 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 333 to 543 (211 residues), 173.7 bits, see alignment E=3.9e-55

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 93% identity to kko:Kkor_1394)

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>B158DRAFT_1578 signal peptide peptidase SppA, 67K type (Kangiella aquimarina DSM 16071)
MSQPNSMIGKFFYRIWKTIDVAGRLMIGLIALTIFILFVRSCTSGPDLPRVDDGAALILA
PKGVIVEQETYLDPIERAMQEAQGIAPNETSIYDLLDAIEYAKNDDRISVMVINVNSLQG
VYAGISKYQDLREAINEFKESGKKVIAVGDYYMQGQFYLASAADEVYMNPFGMLMFEGLG
GNNTYFKSALDNLGVNVHVFRVGTFKSAVEPFIRDDMSEAAKEANREWMGDLWTHMKQDL
AASRDMSVEEFDDFVENYLVKFEAVNGDSGELAVQEGFIDKLMTRGEFRQYMIDMVGLNE
KKDSYKAIGHKNYLKAVRPLVELPSNKDTVAVIVAKGEIVDGSRKEGVIGGDSTARLIQK
ARLDDKVKAIVLRVDSPGGSAFASEVIRSELERAQNEGKVVVASMGGVAASGGYWISATS
DEIWAHPTTITGSIGIFGMVPTFEEPLNKLGVHRDGVGTTKWTLAFDPMDGISPEFAQLI
QRSIERGYDRFLSLVAEGRNMTKEEVDQIAQGRVWSGEDAHRLGLVDQLGDLEDAIESAA
KLANIGDDYAVKFIKRELSAEEVFIRNLLENAKAEGKLDAVIAQLNNGETDIIGHVLGRA
QKIVNIFNNFNDPNHVYAHCMCVGE