Protein Info for B158DRAFT_1569 in Kangiella aquimarina DSM 16071

Annotation: transporter, NhaC family (TC 2.A.35)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 73 to 100 (28 residues), see Phobius details amino acids 103 to 103 (1 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 141 to 168 (28 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 301 to 315 (15 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 372 to 398 (27 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details TIGR00931: Na+/H+ antiporter NhaC" amino acids 7 to 478 (472 residues), 439.7 bits, see alignment E=5.8e-136 PF03553: Na_H_antiporter" amino acids 166 to 473 (308 residues), 182 bits, see alignment E=8.4e-58

Best Hits

KEGG orthology group: K03315, Na+:H+ antiporter, NhaC family (inferred from 96% identity to kko:Kkor_1403)

Predicted SEED Role

"Na+/H+ antiporter NhaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>B158DRAFT_1569 transporter, NhaC family (TC 2.A.35) (Kangiella aquimarina DSM 16071)
MVDSSDRQPSMLQALVPVVFLIVLLFFSVKLFGSDSSYGANQIALILSAAIAILIGLFNG
QTWKELEAGIVDGISLAMGAMLILLMVGSLIGTWILAGTVPTMIYYGLQILSPDFFYVAS
CIICAIVAVSIGSSWTTAGTVGIGLIGISQGLGLDPAITAGAIISGAYFGDKMSPLSDTT
NLAPAVTGTDLFTHIRHMVWTTTPSLIIALVLFTYFGLASDVPAENLELESTLALLDANF
NITLWSLVPLVAVFAMAIKKVPAVATILIGALLGGLFAILTQGEVITKFVNNGELSVTMQ
YVTAVWTALFNGFSISTGDEIFDGLLSRGGMTSMLNTVWLIICAMSFGAAMEKTGLLHKL
VYSIIGMAKSTGSLIGSVLLTCIGMNVIAADQYIAIVLPGRMYRAEFKRRGLDAKNLSRT
LEDAGTITSPLIPWNTCGAYMAATLGVATGAYWIYAFFNLANPIVSFIYGLLNFKIAKHD
EANDAI