Protein Info for B158DRAFT_1566 in Kangiella aquimarina DSM 16071

Annotation: Na+-dependent transporters of the SNF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 85 to 112 (28 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 432 to 456 (25 residues), see Phobius details PF00209: SNF" amino acids 5 to 121 (117 residues), 73.6 bits, see alignment E=7.5e-25 amino acids 144 to 388 (245 residues), 106.5 bits, see alignment E=8e-35

Best Hits

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 96% identity to kko:Kkor_1406)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>B158DRAFT_1566 Na+-dependent transporters of the SNF family (Kangiella aquimarina DSM 16071)
MATDRGQFNTRIGFILAAAGSAVGLGNIWKFPFEVGEGGGAAFVVIYLAFCFLLCFPVMV
SEIAIGRKTNLNPVGAFKKLGHKNWAIIGFMGVLAGVLILSFYNVVAGWAFGYFLEMVQG
NFGIGEEFGSFITDWHKIGLYGLVFMAVTAFIVSRGIHDGIERAATILMPTLFLMIVGLI
IYAMTLDGAGVGINYYLVPDFSEITGEVVYSALGQAFFSLSLGMGALITYGSYVSKKQDI
VKSAALITLTDVSIAFLAGLMIFPFVAYLTQGTMEGVDGGAGLIFATLPGVFESFGPTLG
IVVGSLFFLLLCFAALTSTVSLLEVPVSYLVDEKKIKRPVAVWGMAALIFLIGIPSLLGN
GSVDSLTQFVQMNKNAEWQYVTFMDFVEAIASDTFLPLGGALISFFVAYVWKKHNLNAEI
AIGREGGSQWVAKYIDFAITFFCPVVLGIITVVTILDRFFGVIIIG