Protein Info for B158DRAFT_1564 in Kangiella aquimarina DSM 16071

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 462 to 483 (22 residues), see Phobius details amino acids 495 to 513 (19 residues), see Phobius details amino acids 519 to 540 (22 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 25 to 551 (527 residues), 586.2 bits, see alignment E=1.9e-180 PF01235: Na_Ala_symp" amino acids 60 to 557 (498 residues), 453.5 bits, see alignment E=4.3e-140

Best Hits

Swiss-Prot: 66% identical to DAGA_PSEHA: Na(+)-linked D-alanine glycine permease (dagA) from Pseudoalteromonas haloplanktis

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 90% identity to kko:Kkor_1409)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>B158DRAFT_1564 amino acid carrier protein (Kangiella aquimarina DSM 16071)
MDIVETINNALLYIDGFLGSAGYFPYLLIGVGVFFTLYLGFPQIRYFGQATRIVRGQYAK
KDSPGDTSHFQALTTALSGTVGTGNIGGVALAIFIGGPAALFWMWVTAFFGMTTKFVEVT
LSHKYREKTEDGTMAGGPMYYMEKKLNMKWLAVIFALATIISSIGSGNMPQINNIAQVMN
TTFNIEEWVTGGVLAVLLALVIIGGIKRIAKVAEKIVPFMAVVYVIGALLVIGYNYENIL
PSFQAIFSSIFSGSAAVGGFLGASFAYAMDRGVNRGLFSNEAGQGSAAIAHSAAKGKEPA
SEGMVSLLEPFIDTIIICTLTGLVILSSGVWSEKHQNTFDRTDMEFVVGDYTDNNPEDVN
KLMIHLDEKRSVPSEVKEYTGTISLQNGKAISDGFTLLNARSIAEDVVYKDKDGNPITGE
IPVSNGTLEDSTIVVEGKSLIHSAELTAVAFTKGYMGESGKYVVSLGLLLFAFTTAIAWS
YYGDRAAIYLFGPKSVLPYRIAFVALFFLGAIVDSTVVWTLAYVTVALMTIPNLIGILLL
HKDMKNTVKDYWNNFKSSGAD