Protein Info for B158DRAFT_1561 in Kangiella aquimarina DSM 16071

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details PF00672: HAMP" amino acids 194 to 242 (49 residues), 22.9 bits, see alignment 1.7e-08 PF14501: HATPase_c_5" amino acids 350 to 441 (92 residues), 33 bits, see alignment E=9.4e-12 PF02518: HATPase_c" amino acids 351 to 449 (99 residues), 51.7 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 86% identity to kko:Kkor_1412)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>B158DRAFT_1561 Signal transduction histidine kinase (Kangiella aquimarina DSM 16071)
MSLNHSYSLQKRILLNTSVVLVFFIAAMSFILLNTYKAGIRQATFERLFAQFYSLLSVAD
QLEPGELYLPEEIPSDKRFNQYGSGISALVYDETESLIWQSLSSTYAIEQGKIPLPLTLP
GEPTLDSISLAGEDYFQFHYIAEWESESGEVSLYHFVILENKRPFNQVIETYRNTLWMWL
AGLAASLILILFVVLRWTLKPIRQAVKELRRVEQGLLDKLSDRYPQEIRLLTHNINRFIS
NERHQSKRYKETLGNLAHSLKTPLAVMQAALQNEAEKQELERICSEQLQRMNQIVGYQLQ
RATSGPQVMMKSISLKPAISKLVKGLEKVYSHKGIYIKMDISDSVKVLLNEGDLYEICGN
LLDNACKWAKQKVKISAQQQGLKTIIKIEDDGPGIAEDVRLSVLSRGKRLDESVEGQGIG
MSVVKEIVDAYRGEIDIDVSNLGGALIKVSFNG