Protein Info for B158DRAFT_1515 in Kangiella aquimarina DSM 16071

Annotation: methyltransferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 8 to 324 (317 residues), 451.1 bits, E=5.5e-139
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 8 to 323 (316 residues), 485.1 bits, E=3.5e-150
• PF13489: Methyltransf_23
  • amino acids 113 to 272 (160 residues), 49 bits, E=1.7e-16
• PF13847: Methyltransf_31
  • amino acids 125 to 236 (112 residues), 43.9 bits, E=6.7e-15
• PF13649: Methyltransf_25
  • amino acids 126 to 222 (97 residues), 40.4 bits, E=1.2e-13
• PF08242: Methyltransf_12
  • amino acids 127 to 224 (98 residues), 39.4 bits, E=2.5e-13
• PF08241: Methyltransf_11
  • amino acids 127 to 226 (100 residues), 40.5 bits, E=1.1e-13

Best Hits

Swiss-Prot: 54% identical to CMOB_SHELP: tRNA U34 carboxymethyltransferase (cmoB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 94% identity to kko:Kkor_1455)

MetaCyc: 50% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"putative methyltransferase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (333 amino acids)

>B158DRAFT_1515 methyltransferase, putative (Kangiella aquimarina DSM 16071)
MINFTNTYNAIADTRLHPWLDQFKHAVNQRMADYTHGNLSDWIKLLKELPDITPDHIELA
SKVEIGSTSQLSEDEQKQLKQLLMKFHPWRKGPFHLFGQHIDTEWRSDWKWDRLKDQISS
LEDRIVLDVGCGNGYHCWRMAAHNPKLVIGIDPSQLFLMQFAVMQTYLADYPVHYLPVGL
EYLPENLSDQGFDTIFSMGVLYHRRSPIDHILHMKNLLRPGGELVLETLVIDGEADQCLI
PKDRYAQMNNVWFIPTTGMLKNWMAKLDFQDIKIANVAKTGLDEQRATEWMTFQSLEDYL
DPQNKDLTIEGYPAPKRAVIIATKPGSRKKAGK