Protein Info for B158DRAFT_1505 in Kangiella aquimarina DSM 16071

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpA (EC 3.4.21.92)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 732 (730 residues), 1111.5 bits, see alignment E=0 PF02861: Clp_N" amino acids 17 to 62 (46 residues), 44.2 bits, see alignment 1.2e-14 PF00004: AAA" amino acids 209 to 310 (102 residues), 47 bits, see alignment E=2.5e-15 amino acids 490 to 607 (118 residues), 40.1 bits, see alignment E=3.5e-13 PF17871: AAA_lid_9" amino acids 350 to 451 (102 residues), 100.5 bits, see alignment E=3.4e-32 PF07724: AAA_2" amino acids 484 to 645 (162 residues), 214.5 bits, see alignment E=6.7e-67 PF07728: AAA_5" amino acids 489 to 605 (117 residues), 50.4 bits, see alignment E=1.7e-16 PF10431: ClpB_D2-small" amino acids 651 to 730 (80 residues), 81.3 bits, see alignment E=3.1e-26

Best Hits

Swiss-Prot: 65% identical to CLPA_ECOLI: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli (strain K12)

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 95% identity to kko:Kkor_1464)

MetaCyc: 65% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (754 amino acids)

>B158DRAFT_1505 ATP-dependent Clp protease ATP-binding subunit ClpA (EC 3.4.21.92) (Kangiella aquimarina DSM 16071)
MLDKALEKSLNHAFHDAREKRHEFITIEHLMLALLDNKDALEVLRAVGADIGVLKSDLEK
FVNQTTPQFSDEDDEFEIQPTIGFQRVLQRAVFHVQSSGREAVSGANVLVAMFSEPESQA
VFLLSKQDISRLDVVNYISHGVSSDEEDFPELEHDEGEQEPQEPRPLDQYAVNLNKLAEQ
GRIDPLIGRANEIERVVQVLCRRRKNNPLLVGEAGVGKTAIAEGLAKRIVDGDVPEVIAD
AVVYALDLGVLLAGTKYRGDFEKRLKAVLAQLKKESHAILFIDEIHTIIGAGAASGGTMD
ASNLIKPVLANGELRCLGSTTFQEYRGIFEKDHALARRFQKIDINEPSVLDTIGILEGLK
ERYEKHHGVTYSKQAIQAAAELSAKYINDRQLPDKAIDVIDEAGARQRILPEEQRKKTIT
PHEIEQVIAKIARIPEKTVSSSDKKLLQNLERNLKMVVFGQDQAIETLSESIKLSRAGLG
QENKPVGSFLFAGPTGVGKTEVTKQLARLMGVELIRFDMSEYMERHTVSRLIGAPPGYVG
YDQGGLLTEAVNKNPHAVVLLDEIEKAHPDVFNLLLQVMDHGTLTDNNGRKADFRNIVLV
MTSNAGAQEIIKGNIGFKEQDKSRNNEEAINRTFSPEFRNRLDAIVWFNSLPQKVILSIV
DKFLTEVQGQLDDKQVNLHVDDTARHWFAQHGYDENMGARPMARLISDKIRRPLANEILF
GKLMQGGDVYVSLKNDELDIRIEPHMEKLPQGTS