Protein Info for B158DRAFT_1477 in Kangiella aquimarina DSM 16071

Annotation: pyruvate dehydrogenase E1 component, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR03181: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 13 to 351 (339 residues), 448.5 bits, see alignment E=6.5e-139 PF00676: E1_dh" amino acids 42 to 330 (289 residues), 268.9 bits, see alignment E=4.7e-84 PF13292: DXP_synthase_N" amino acids 138 to 200 (63 residues), 25.9 bits, see alignment E=6.1e-10

Best Hits

Swiss-Prot: 40% identical to ODPA_MYCGE: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 96% identity to kko:Kkor_1491)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1, 1.2.4.4

Use Curated BLAST to search for 1.2.4.1 or 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>B158DRAFT_1477 pyruvate dehydrogenase E1 component, alpha subunit (Kangiella aquimarina DSM 16071)
MTTTTVASFEIKYHQYLDAQGKPTQELPAFAKDMDKMRKLYRDMALLRAFDAKAYALQRT
GKMGTYPASLGQEAIGIGYGDAMTSEDVLIPYYRSTGAMLKHGITMEEILLYWGGDESGS
NYSVAKEDFPICVPIANQIIHASGVAKAIQMRGQKRAVATEIGEGGTSEGDFYEGINVAG
IWNLGVVFMVNNNQWAISVPTEIQTACETYAQKAIAAGIEGVQVDGNDIIAVKQVAEYAF
EKARNGGGPTLIEAITYRLCDHTTADDASRYDDPKVKEEAWKNEPMVRLRKYLEANKAWS
DKDEEAMKAEIAKEVDAAVKAYEETPKPGPELMFDHLYAELPELTKPQREAAIKLAEKAR
GAK