Protein Info for B158DRAFT_1425 in Kangiella aquimarina DSM 16071

Annotation: 2-oxoglutarate dehydrogenase E2 component (EC 2.3.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 3 to 414 (412 residues), 591.9 bits, see alignment E=3.9e-182 PF00364: Biotin_lipoyl" amino acids 4 to 75 (72 residues), 62.8 bits, see alignment E=3.2e-21 PF02817: E3_binding" amino acids 122 to 155 (34 residues), 48.6 bits, see alignment 1.2e-16 PF00198: 2-oxoacid_dh" amino acids 185 to 413 (229 residues), 298.9 bits, see alignment E=3.5e-93

Best Hits

Swiss-Prot: 51% identical to ODO2_BARVB: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Bartonella vinsonii subsp. berkhoffii

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 93% identity to kko:Kkor_1540)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>B158DRAFT_1425 2-oxoglutarate dehydrogenase E2 component (EC 2.3.1.61) (Kangiella aquimarina DSM 16071)
MAIEIKVPVLPESVADATIATWHVKPGESVSRDQNLVDIETDKVVLEVVAPDDGVISEII
KEEGDTVLQEEVIAKFEAGASGDAKAESSDDKKDSSSKEESSKEEKKEEAKEETSSADLD
VLSPAVRRLVAEHNLDPKQIPASGKGGRLTKEDVEKFIKDGGASAKSSDSKKDSGSAPVS
AGLREEKRVPMTRLRKRIAERLVEAQHTAAILTTFNDINMKEVVDLRARYKEQFEKVHGT
RLGFMSFFVKATVEALKRYPAVNASIDGDDIVYHGYYDIGVAVSSPRGLVVPVLRDADTL
SLAEIEAKIREFGEKARDNKLTVEDMTGGTFTISNGGVFGSLMATPIINPPQSGILGMNR
MEDRPVVINGEIVIRPMMNVALSYDHRIIDGRESVGFLKTIKEFIEDPARMLLDL