Protein Info for B158DRAFT_1402 in Kangiella aquimarina DSM 16071

Annotation: L-erythro-3-methylmalyl-CoA dehydratase (EC 4.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF19315: MC_hydratase
  • amino acids 6 to 297 (292 residues), 60.9 bits, E=1.9e-20
• PF01575: MaoC_dehydratas
  • amino acids 15 to 126 (112 residues), 42 bits, E=1e-14
• PF13452: MaoC_dehydrat_N
  • amino acids 19 to 139 (121 residues), 22.2 bits, E=2.1e-08

Best Hits

Swiss-Prot: 51% identical to MCH_CHLAA: Beta-methylmalyl-CoA dehydratase (mch) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K14449, mesaconyl-CoA hydratase (inferred from 91% identity to kko:Kkor_1561)

MetaCyc: 51% identical to beta-methylmalyl-CoA dehydratase monomer (Chloroflexus aurantiacus)
RXN-8960 [EC: 4.2.1.148]

Predicted SEED Role

"Mesaconyl-CoA hydratase"

MetaCyc Pathways

• methylaspartate cycle (11/19 steps found)
• glyoxylate assimilation (6/13 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (1/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.148

Protein Sequence (353 amino acids)

>B158DRAFT_1402 L-erythro-3-methylmalyl-CoA dehydratase (EC 4.2.1.-) (Kangiella aquimarina DSM 16071)
MNKSSAGRFFEDFSLGQLIEHPIPRTITEGDASLYIALTGSRFSLFSSHHLARKVGFAKP
PVDNLLLFHIAFGKTVQDISLNAVANLGYAEVQFVLPAFIGDTISVLSEVIGLKENSNGK
TGIVYVHSRATNQDGHLVASWKRWVMVHKKEEGMQNTYAVQPQLNSEVSPAHLAMPDQFN
ADNYSYISSGETFVFKDYQVGEWIDHIDGLTIDATEHTMATKLYQNNAKVHFNYHQMQDS
QHQQRLVYGGHIISLCRSLSHNGLANAQWLAAINGGAHLNPTYAGNTIYAATQVQNKYDL
GFGMGALRLKTIGFKNIQWSSIKEQVSSANSVKDYPDNVVLDLDYTVLIPNPK