Protein Info for B158DRAFT_1390 in Kangiella aquimarina DSM 16071

Annotation: sulfur relay protein, TusE/DsrC/DsvC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04358: DsrC
  • amino acids 7 to 108 (102 residues), 136.8 bits, E=1.9e-44
• TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family
  • amino acids 7 to 108 (102 residues), 147.1 bits, E=1.1e-47

Best Hits

Swiss-Prot: 64% identical to TUSE_HAEIN: Sulfurtransferase TusE homolog (tusE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 89% identity to kko:Kkor_1579)

MetaCyc: 59% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-) @ Dissimilatory sulfite reductase, gamma subunit (EC 1.8.99.3)" (EC 1.8.99.3, EC 2.8.1.-)

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (5/11 steps found)

KEGG Metabolic Maps

• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 1.8.99.3 or 2.8.1.-

Protein Sequence (108 amino acids)

>B158DRAFT_1390 sulfur relay protein, TusE/DsrC/DsvC family (Kangiella aquimarina DSM 16071)
MIDLLAELARDKQGYLTDSSVWNEKIANAIAKEESIELTDDHWQVIWYVRKFYEEFNTSP
SIRPLVKYLAKEWSPEKGTSIYLHILFPEGPAKQATKIAGLPKPARCI