Protein Info for B158DRAFT_1382 in Kangiella aquimarina DSM 16071

Annotation: Predicted sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF17773: UPF0176_N" amino acids 29 to 119 (91 residues), 102.2 bits, see alignment E=1.6e-33 PF00581: Rhodanese" amino acids 140 to 234 (95 residues), 47.7 bits, see alignment E=1.8e-16

Best Hits

Swiss-Prot: 75% identical to Y522_HAHCH: UPF0176 protein HCH_00522 (HCH_00522) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K07146, UPF0176 protein (inferred from 94% identity to kko:Kkor_1587)

Predicted SEED Role

"Rhodanese domain protein UPF0176"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>B158DRAFT_1382 Predicted sulfurtransferase (Kangiella aquimarina DSM 16071)
MSQTKSVSAESSAVSTSSSVYNETTHPIVVCAMYKFVTLEDFEAIRQPLLDVMLENDIKG
TLLLAKEGINGTVAGTRQAIDTLLAWFKHDERLADIDYKESYDEEMPFYRTKVKLKKEIV
TMGVEGIDPKRVVGTYVKPKDWNALISDPEVVLVDTRNDYEVQIGTFKGALNPNTETFRE
FPEYVKQNLDPNKHKKVAMFCTGGIRCEKSTAYLKEQGFENVFHLEGGILKYLEEVPQEE
SMWEGECFVFDNRVAVDHELKKGQYDQCHACRMPITEEEKQHEKYEKGVSCPHCYDKQTP
EQRQRYAERERQVQLAKARGEEHIGSDVLTAIAMRRQQKKRMREMQKQAQKHKAKS