Protein Info for B158DRAFT_1346 in Kangiella aquimarina DSM 16071

Annotation: 2-methylaconitate cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR02334: probable AcnD-accessory protein PrpF" amino acids 12 to 401 (390 residues), 738.9 bits, see alignment E=5.7e-227 PF04303: PrpF" amino acids 13 to 400 (388 residues), 618.4 bits, see alignment E=2.3e-190

Best Hits

Swiss-Prot: 78% identical to PRPF_CUPNE: 2-methyl-aconitate isomerase from Cupriavidus necator

KEGG orthology group: K09788, hypothetical protein (inferred from 91% identity to kko:Kkor_1002)

Predicted SEED Role

"2-methylaconitate cis-trans isomerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>B158DRAFT_1346 2-methylaconitate cis-trans isomerase (Kangiella aquimarina DSM 16071)
MSKQFPPQTHSPQIRIPATYMRGGTSKGVFFNLTDLPEAAQVPGQARDNLLLRVIGSPDP
YGKQTDGMGGATSSTSKTVILSKSSKPDHDVDYLFGQVSIDKPFVDWSGNCGNLTAAVGS
FAITSGLVDSSRIPDNGVAVVRIWQANIEKTIVAHVPITNGEVQETGDFELDGVTFPAAE
VKVEFMDPADGEGSMFPTGNLVDDLEVPGLGTLKATMINAGIPTIFLNASDIDFNGTTYN
GTELQEAINSDGHALSMFEVIRAHGAVKMGLIKDIEEAANRQHTPKVAFVAPPADYVSSS
GKQINASDIDLNVRALSMGKLHHAMMGTAAVAIATAATIPGTLVNLAAGGGERQGVTFGH
PSGTLKVGAETEKQGNDWVAKKVIMSRSARVLMEGWVRVPQIQF