Protein Info for B158DRAFT_1343 in Kangiella aquimarina DSM 16071

Annotation: methylisocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR02317: methylisocitrate lyase" amino acids 4 to 287 (284 residues), 411.5 bits, see alignment E=8e-128 PF13714: PEP_mutase" amino acids 8 to 247 (240 residues), 151 bits, see alignment E=4.4e-48 PF00463: ICL" amino acids 78 to 174 (97 residues), 59.5 bits, see alignment E=2.5e-20

Best Hits

Swiss-Prot: 67% identical to PRPB_VIBCH: 2-methylisocitrate lyase (prpB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03417, methylisocitrate lyase [EC: 4.1.3.30] (inferred from 97% identity to kko:Kkor_0998)

MetaCyc: 67% identical to 2-methylcitrate lyase (Cupriavidus necator)
Methylisocitrate lyase. [EC: 4.1.3.30]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>B158DRAFT_1343 methylisocitrate lyase (Kangiella aquimarina DSM 16071)
MSAGLKFRKAVEENHPLQLMGTITAYTARMAEKIGHKAIYLSGGGVAANSLGMPDLGIST
AEDLLVDIRRITDVCSLPLMVDIDTGFGGAFNIARTTRALIKAGAAGFHMEDQVATKRCG
HRPNKEIVSQQEMVDRVKSAVDARTDENFVIMARTDALAVEGMQSAIDRANACIEAGADM
IFPEAMRSLEDYETFRKHVNVPFLANITEFGATPLFSCEELAGVGVDIVLYCCGAYRAMN
KGAETFYKDVLAKGHQRDVIDIMQTREELYDYLGYHEYEQKLDELFAQEKAKNK