Protein Info for B158DRAFT_1339 in Kangiella aquimarina DSM 16071

Annotation: L-serine dehydratase, iron-sulfur-dependent, single chain form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 3 to 454 (452 residues), 729.6 bits, E=7.6e-224
• PF03315: SDH_beta
  • amino acids 4 to 157 (154 residues), 219.3 bits, E=3.3e-69
• PF03313: SDH_alpha
  • amino acids 188 to 451 (264 residues), 323.1 bits, E=1.6e-100

Best Hits

Swiss-Prot: 67% identical to SDHL_STRCO: L-serine dehydratase (sdaA) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 96% identity to kko:Kkor_0994)

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• D-serine degradation (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• glycine betaine degradation III (4/7 steps found)
• L-methionine biosynthesis II (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (8/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Protein Sequence (457 amino acids)

>B158DRAFT_1339 L-serine dehydratase, iron-sulfur-dependent, single chain form (Kangiella aquimarina DSM 16071)
MAISVFDMFSIGIGPSSSHTVGPMRAAHRFIEFLTEKDLLNSISRVKAELYGSLGATGKG
HGSDKAVMIGLEGHLPEEVDPDIIPARLETIRSEKKIKLNGTTELKFNEEKDLVMHRRKS
LPRHSNGMIFLAFDKDGNEIAKKTYYSVGGGFVVNEDVDADTPIMEDDTKVKYPFTTAAE
LIQTCKDEGICISTLMLENEKSWRSEEEVKAKLLEIWHVMEDCIKRGCNREGILPGGLKV
KRRAPGIYRKLKSDSNENDVLRAMDWVDLYALAVNEENAAGGRVVTAPTNGAAGIIPAVL
FYFMRFHQNADEKAVIRFLLTAGAIGILYKLNASISGAEVGCQGEVGVACSMAAGALTEI
MGGSPQQVENAAEIGMEHNLGLTCDPVGGLVQVPCIERNAMASVKAINAARLALRGDGEH
KVSLDKVIKTMWDTGMDMRDKYKETARGGLAVHIIEC