Protein Info for B158DRAFT_1336 in Kangiella aquimarina DSM 16071

Annotation: 5'-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06189: 5-nucleotidase
  • amino acids 1 to 298 (298 residues), 444.7 bits, E=5.8e-138

Best Hits

KEGG orthology group: K01081, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 98% identity to kko:Kkor_0991)

Predicted SEED Role

"5'-nucleotidase (EC 3.1.3.5)" in subsystem Purine conversions (EC 3.1.3.5)

MetaCyc Pathways

• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• guanosine nucleotides degradation II (1/4 steps found)
• guanosine nucleotides degradation III (1/4 steps found)
• purine nucleotides degradation II (aerobic) (6/11 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• ureide biosynthesis (2/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (1/6 steps found)
• NAD salvage (plants) (4/11 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• tunicamycin biosynthesis (1/9 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Protein Sequence (303 amino acids)

>B158DRAFT_1336 5'-nucleotidase (Kangiella aquimarina DSM 16071)
MPMDFKDTLVIAISSTALFDLAESHRIYMEKGVNSYAQYQIDHEDELLKPGAAFGLVRKL
LAINDGAKDKPRVEVILLSRNSADTGLRVFNSIENHRLQITRAAFTSGNSPYLYAEAFGA
HLFLSTNPVDVTQAIEAGIAAATIVAPTQASNESDIIKFAFDGDAVLFSDESEQIFQSGG
LEEFTKHEKASAQKPLEGGPFKNFLAALHKLQKEFGTEDCPIRTALVTARSAPAHERVIR
TLRYWDIRIDEALFLGGMDKTRFLKAFGADVFFDDQEGHIERAREHIASGHVPNGVINKK
KAQ