Protein Info for B158DRAFT_1331 in Kangiella aquimarina DSM 16071

Annotation: Cytochrome c biogenesis factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details PF13174: TPR_6" amino acids 175 to 201 (27 residues), 17.2 bits, see alignment (E = 1.2e-06)

Best Hits

KEGG orthology group: None (inferred from 85% identity to kko:Kkor_0986)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>B158DRAFT_1331 Cytochrome c biogenesis factor (Kangiella aquimarina DSM 16071)
MIAWIVLTLVALAWAAWLFGGVFKSSNKKVLYSGMLLISSVLSLFIYFKMGAHAELEALS
EKHQSLAGLSLVELAEKAQNDEITALEFLTELRLRSEQDPDNKEKWLQLGQIFLRFGEID
EADQAFVRAIDLEPTDASRLQVAQIFLESDDQAAFQRADRHIGLVLMEQPNHEGALLMQG
VNQFKQQNYQAAIDYWQRLLDMREPGSQSAQLMREQIARAEHQLKLQQTNNIRVFVDNIS
ELPLEQFSKAFVLVRSYAGGPPVAVRSVALSELEGGVLLTPGDVMLPDVELWQAQDVIVE
IRLSIEGIAQPGAGDQFGRTERLDKLTPGEQFHIEINQTVN