Protein Info for B158DRAFT_1253 in Kangiella aquimarina DSM 16071

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details PF01925: TauE" amino acids 12 to 242 (231 residues), 118.5 bits, see alignment E=4e-38

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 89% identity to kko:Kkor_1718)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>B158DRAFT_1253 Predicted permeases (Kangiella aquimarina DSM 16071)
MTEVVIYWSVAVIAVLITGISKSGFAGGAGAVAVPLLSLVMSPLQAIALMLPLLIIMDGF
SVKLWWGQYNRKLLIALIPASVIGVAVGYATADQLSEDWIRLILGVIAIGFVLMQLLPNK
QGSESNKPNAFFGAIAGASAGFTSFLAHAGGPPLNMYLLKQKLQRSEFLATAVYFFAAIN
LFKLYPYIALEQFNKQVLWQGALLIPVALIGVALGKWLQSHLSQKTFLNIIYVLLFGLGC
KLIYSALSELL