Protein Info for B158DRAFT_1245 in Kangiella aquimarina DSM 16071

Annotation: Outer membrane cobalamin receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07715: Plug" amino acids 86 to 171 (86 residues), 56.1 bits, see alignment E=5e-19 PF00593: TonB_dep_Rec" amino acids 184 to 621 (438 residues), 79 bits, see alignment E=7.2e-26

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 69% identity to kko:Kkor_1727)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>B158DRAFT_1245 Outer membrane cobalamin receptor protein (Kangiella aquimarina DSM 16071)
MKFHKLYGALILSCSVCVFGSESSTEYLAAECESNCTSPQKEWKQKNSLEDEKIKNVTVI
AGSTPSHFTDLNSVSRLVSPTQKTIAPTSILDLLTEVPGVAENGQAGLFQVYSIRGLSRH
RVLTYLSDIPLKAERRAGVATSFVHPLLFDYAEVSRGPASTLYQSGSLGGVVKLSPATFD
HSFLSVDYQTQGNRNNQIYGTGSNDWSVAVARQFSNNTEDPNGNELNSGYEQYSGSFIKQ
WRIADVDYEWMLLMSEGNDIGRSSTQYPDRLVTVPNEEHLLSQLSARGDDWRATVYFHPN
RLNTLTVRPEQRVNDVTNESRDYGFHYENNWFVNKLEGLWGLDGFKRSGINAFETELSLA
DNSMTSTQSLNGATERELATFATLNSYWGDTKWQFGTRLLNNRQTNPGFAASEDDAITGF
IGFSMSISTNWILTANLGTGVRFATVSERYFVGTTGRGEVIGNPDLETERSVSSDLGVKY
SDVDKQFILNIYRQKVSDYIERVEVSPGVLTYNNLNNGLIYGAELDANFDFNEQWELGIG
GMWVKGQDDDNQELADIPANRFKMRVRYNGEDWSIDGALQYRFSKDRFSSGERATPAAWV
GELAFSKQLGNGLNLSLFVDNFLDEKYYSSSDDIAPLAEGRSFGVKFTKMW