Protein Info for B158DRAFT_1235 in Kangiella aquimarina DSM 16071

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00578: AhpC-TSA
  • amino acids 5 to 140 (136 residues), 123.4 bits, E=8.1e-40
• PF08534: Redoxin
  • amino acids 5 to 149 (145 residues), 63.7 bits, E=2.5e-21
• PF10417: 1-cysPrx_C
  • amino acids 161 to 195 (35 residues), 51.4 bits, 1.2e-17

Best Hits

Swiss-Prot: 55% identical to AHPC_BUCBP: Alkyl hydroperoxide reductase C (bbp_171) from Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 98% identity to kko:Kkor_1737)

MetaCyc: 52% identical to peroxiredoxin-1 (Homo sapiens)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Protein Sequence (201 amino acids)

>B158DRAFT_1235 Peroxiredoxin (Kangiella aquimarina DSM 16071)
MGVLVGRKAPDFTAAAVLGNGEIVEDFNFAEATKGKPTVVFFYPLDFTFVCPSELIAFDH
RLDEFKKRGVEVIGVSIDSHFTHNAWRNTDIKNGGIGQVGYTLVADVKHEICQAFDVEHP
EAGVAFRGSFLIDKDGVVRHQVVNDLPLGRNVDEMIRMVDALQFHEEHGEVCPAGWNKGD
KGMDATPEGVAKYLSESADKL