Protein Info for B158DRAFT_1227 in Kangiella aquimarina DSM 16071

Annotation: ABC-type spermidine/putrescine transport systems, ATPase components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 25 to 169 (145 residues), 116.8 bits, see alignment E=1.8e-37 PF08402: TOBE_2" amino acids 281 to 343 (63 residues), 26.2 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 43% identical to FBPC2_HAEIN: Fe(3+) ions import ATP-binding protein FbpC 2 (fbpC2) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 94% identity to kko:Kkor_1745)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>B158DRAFT_1227 ABC-type spermidine/putrescine transport systems, ATPase components (Kangiella aquimarina DSM 16071)
MSEFSDHPILQLNDVQCRHGDQIIVNHIDFKLKAGDSACLLGPSGCGKTTLLRAIAGLEP
IYEGFISIHGRFCSKPDFTLPPEKRHLGLVFQDHALFPHLNIFDNVAFGLRHLPRKERRE
RVQECLELVGLEAMEKRYPHQLSGGQQQRVALARSIAPRPELILLDEPFSSLDTHLRRSL
ARELKELLKAQNIASLLVTHDQQEAFAMADYIGVMHQGKLLQWDTPYNLYHKPVDAQIAS
FIGEGHFIAGTITDRQHVNTVLGNFTIANGKTFTPNDSVLVLMRPDDVKPNMNSPLRGKV
THKVFKGAIIEYELELSNNEQLKAIFPSHHDYPLSQDIGFDLDVKHLIVYPDHISL