Protein Info for B158DRAFT_1223 in Kangiella aquimarina DSM 16071

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 84 to 238 (155 residues), 70 bits, see alignment E=1e-23 PF00990: GGDEF" amino acids 85 to 236 (152 residues), 91.4 bits, see alignment E=5.6e-30 PF00563: EAL" amino acids 266 to 492 (227 residues), 229.9 bits, see alignment E=3e-72

Best Hits

KEGG orthology group: None (inferred from 70% identity to kko:Kkor_1756)

Predicted SEED Role

"putative diguanylate phosphodiesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>B158DRAFT_1223 diguanylate cyclase/phosphodiesterase (Kangiella aquimarina DSM 16071)
MKDVKSETMTKRKLTTAVRGAVIYAAIGGLWILFSDKALESFTNDVDYITVAQTYKGWFY
VLVTSVLLFILLKRAIENTERLLSLDPLTQLPRHYQFTRLLDRQVKNISKEKKVVLIYLD
LCKFSQINQEFGHRKGDAVLQKLTGELWECFHENGVLGRLGSDQFGIAIKVKNNDRLIEE
LPDLIFRMTQRVGVELKIPLKVCLGLAIAPFDGKDSKSLLSAASIALHNAKKIGDDQCSF
FSHELSEIALHRQRLITELKSTDVFQHFKTVYQPQLSISDQSITGVEVLIRWIHPELGFI
SPEDFIPIAEDIGAMPNISRWVITNAKKELNETNLIPEKIKRVSINISARELNIEEQAQN
LHQVFKENLDFAKICQIEITETTAIYDITTSQKFIESLKELGLKFSIDDFGTGFTSLSNL
KNLPVDELKIDRSFIDKIETENNSQIIVKSVIDLADNFGIKSIAEGVENENQLIFLKNCG
CDEAQGYYFAKPMGIEDLKKFMAA