Protein Info for B158DRAFT_1217 in Kangiella aquimarina DSM 16071

Annotation: Predicted membrane protein (DUF2157).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 51 to 73 (23 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 145 to 176 (32 residues), see Phobius details amino acids 182 to 198 (17 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details PF09925: DUF2157" amino acids 19 to 164 (146 residues), 105.3 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 76% identity to kko:Kkor_1759)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>B158DRAFT_1217 Predicted membrane protein (DUF2157). (Kangiella aquimarina DSM 16071)
MEPKQLTKKQKHWLQYESDEWVEQGIINSQQQSQILGRYSTSHIESFYSSWSSLLLISLG
AILIGGGIVLLIAHNWESFGKGTRTVLSILPLLLAQALTWYSVRYKPQLTGLREASGILL
FFAVAASIALISQTYHIYGDLERFLVTWLLLGIPTLYLVESAGVLMLVCALILWLCGLER
EPYWLYYLSLVPYLYSLFKRQRLALFHWALWFIVIGTTISIIYSVAWNSPLDHWMIYITL
ALCGFYYSLGKWLFGFKEHGFWTNPLCTAGVLGILFISLLLTWEDFYRYSHLDTDGKWGF
NDYLILSVFAISIVSIVGFLIHKFKSLQIHQWLLIGSVLLAGLGMAGFHLGLSELVYIVL
VNVYVLVASVILMSQGIQQHRLMLLNGGLLWFSFLVLFRFFDSDIPFVLKGVVFIFIGSA
FIGVNIWYNKKLKQQAEQQEAGA