Protein Info for B158DRAFT_1216 in Kangiella aquimarina DSM 16071

Annotation: Ion channel.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 87 to 100 (14 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details PF07885: Ion_trans_2" amino acids 53 to 136 (84 residues), 52.7 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_1760)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>B158DRAFT_1216 Ion channel. (Kangiella aquimarina DSM 16071)
MIFILVVTVILIMLTVGVHYQALYSISVFLERIKTAGRYKVMLGVLLALIAHFIEIWIFG
IAYYLIGNYHESPDKLVNVDGQIVNDFFSCIYFSFASYSSLGFGDIVPEGPIRFMAGIEA
VIGLVFIAWTASLLYIEMQKHWIKPHPK