Protein Info for B158DRAFT_1215 in Kangiella aquimarina DSM 16071

Annotation: Superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 4 to 82 (79 residues), 110.4 bits, E=4.9e-36
• PF02777: Sod_Fe_C
  • amino acids 89 to 190 (102 residues), 139.4 bits, E=3.8e-45

Best Hits

Swiss-Prot: 77% identical to SODF_ECOL6: Superoxide dismutase [Fe] (sodB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 97% identity to kko:Kkor_1761)

MetaCyc: 77% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (193 amino acids)

>B158DRAFT_1215 Superoxide dismutase (Kangiella aquimarina DSM 16071)
MAIELPALPYDRDALTPHISEETINYHYGKHHQAYVTNLNNMIAGTDFEGKSLEDIIRTS
EGGVFNNAAQVWNHTFYWNSLSPNGGGEPSGALADAINSAFGSFADFKEKFTASAAGNFG
SGWTWLVKNSSGALEIVNTSNAGTPITNAGVTPLLTVDVWEHAYYVDYRNARPEYLKHFW
ELVNWDFAAKNFA