Protein Info for B158DRAFT_1212 in Kangiella aquimarina DSM 16071

Annotation: Spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01564: Spermine_synth
  • amino acids 88 to 224 (137 residues), 52.1 bits, E=9.1e-18
• PF01596: Methyltransf_3
  • amino acids 94 to 203 (110 residues), 26.5 bits, E=5.6e-10
• PF13847: Methyltransf_31
  • amino acids 95 to 224 (130 residues), 29 bits, E=1.2e-10

Best Hits

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 88% identity to kko:Kkor_1763)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• spermidine biosynthesis I (2/2 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• superpathway of polyamine biosynthesis II (5/8 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• L-methionine salvage cycle III (4/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (3/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Protein Sequence (303 amino acids)

>B158DRAFT_1212 Spermidine synthase (Kangiella aquimarina DSM 16071)
MKSLIVKTILTTLTASALFLAAPEQANAKIIEQERSLYQNVYMVEEYGMHCMRFRKKNKN
DLSQSCVFLDAPEIFVFDYYKQAMGATFFLDDPKEILIIGLGGGVLANTFGEVYPDAHIT
SVEIDPVVVKMAKKYFDYDDSKANFETHVRDGRVFVKRALKDDKRYDFILLDAFNSDYIP
EHMMTKEYLEEVKALAKDDGIIMANTFSTSDLFHHESATYAEVFGPLYQINFKNKKTNRV
IVVSKKPLPEKRQLLQKANELKGELLIYGVDTLALFDAISDEVNWDTEAEVLTDQYSPAN
LLK