Protein Info for B158DRAFT_1196 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF17775: UPF0225" amino acids 34 to 130 (97 residues), 105 bits, see alignment E=3.3e-34 PF02810: SEC-C" amino acids 142 to 159 (18 residues), 36.3 bits, see alignment (E = 4e-13)

Best Hits

Swiss-Prot: 41% identical to Y1852_VIBCH: UPF0225 protein VC_1852 (VC_1852) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 82% identity to kko:Kkor_1782)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>B158DRAFT_1196 Uncharacterized protein conserved in bacteria (Kangiella aquimarina DSM 16071)
MNTNCPCRMKENTNLLNYSDCCEPFHLGNALPETPEQLMRSRYTAYYLGLGQYIFDTHHI
DFRGNTSVEEFTHSAQATRWCGLEVIHAEQEADKGLVEFKAYFLDKDKLHCLNEASNFVR
ETGRWLYTDGEFKPKSVVKNSRNDPCPCGSGKKAKKCCLMD