Protein Info for B158DRAFT_1160 in Kangiella aquimarina DSM 16071

Annotation: tRNA-adenosine deaminase (EC 3.5.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 6 to 105 (100 residues), 98.7 bits, E=1.6e-32
• PF14437: MafB19-deam
  • amino acids 9 to 153 (145 residues), 125 bits, E=2.1e-40

Best Hits

Swiss-Prot: 52% identical to TADA_ECOL6: tRNA-specific adenosine deaminase (tadA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11991, tRNA-specific adenosine deaminase [EC: 3.5.4.-] (inferred from 84% identity to kko:Kkor_1829)

MetaCyc: 52% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Protein Sequence (159 amino acids)

>B158DRAFT_1160 tRNA-adenosine deaminase (EC 3.5.4.-) (Kangiella aquimarina DSM 16071)
MTDFTEFDHNCMQRAFELAAIAEEKGEVPVGAVLAKEGEIISEGFNQPILSHDPTAHAEM
VALRAAGAQIENYRLVNSTLYVTLEPCAMCAMAMVHARVARVVFATPDPRTGAAGSVLNI
LQNPNFNHQCQVESGLLQDDCSEQLKRFFRNKRKSSDKK