Protein Info for B158DRAFT_1155 in Kangiella aquimarina DSM 16071

Annotation: Beta-barrel assembly machine subunit BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 8 to 378 (371 residues), 396.3 bits, see alignment E=5.4e-123 PF13360: PQQ_2" amino acids 76 to 307 (232 residues), 201.6 bits, see alignment E=2.3e-63 PF13570: PQQ_3" amino acids 87 to 125 (39 residues), 22.1 bits, see alignment 2.5e-08 amino acids 127 to 166 (40 residues), 31.1 bits, see alignment 3.5e-11 PF01011: PQQ" amino acids 108 to 143 (36 residues), 24.2 bits, see alignment 3e-09 amino acids 193 to 229 (37 residues), 24.5 bits, see alignment 2.6e-09

Best Hits

Swiss-Prot: 83% identical to BAMB_KANKD: Outer membrane protein assembly factor BamB (bamB) from Kangiella koreensis (strain DSM 16069 / KCTC 12182 / SW-125)

KEGG orthology group: None (inferred from 83% identity to kko:Kkor_1835)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>B158DRAFT_1155 Beta-barrel assembly machine subunit BamB (Kangiella aquimarina DSM 16071)
MISGWTQRIVTLLIATSFLVACSDEVVNPPKELDDIEEKFSIESAWVEVIGDGDDGKFNS
LIPAIWEDKVITADVKGLISAFDLKTGDLIWETQLKEPLSGGVTANAGLVAVGTKDAKVH
VLDINDGKKLWHVDVTTEVLAKPAIDDGRLVVRTPDGRIFAYSLATQKQEWFYDRIIPNL
TLRGTSAPVATSGIVISGFANGKMAAFNIRTGDLLWEQRISAPRGSSEISRIVDVDSSPV
IYSNYLYAAGFNGYAIAMDLTNGRYLWREETSVTQELLVDATRVYLVETTGKIVALDRFT
GEQVWSQEGLLYRKPTGAADNEDYIVVGDFEGYLHWLDKSTGEFVARTHLDRYGVAHAPI
VTDEHIIATTRYGYLHVMENPIASSSEE