Protein Info for B158DRAFT_1127 in Kangiella aquimarina DSM 16071

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF13492: GAF_3" amino acids 38 to 148 (111 residues), 27.4 bits, see alignment E=7.6e-10 PF01590: GAF" amino acids 39 to 167 (129 residues), 31 bits, see alignment E=6.9e-11 PF13185: GAF_2" amino acids 39 to 167 (129 residues), 52 bits, see alignment E=1.8e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 182 to 340 (159 residues), 136 bits, see alignment E=5.2e-44 PF00990: GGDEF" amino acids 184 to 339 (156 residues), 148.2 bits, see alignment E=3.8e-47

Best Hits

KEGG orthology group: None (inferred from 79% identity to kko:Kkor_1862)

Predicted SEED Role

"Diguanylate cyclase with GAF sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>B158DRAFT_1127 diguanylate cyclase (GGDEF) domain (Kangiella aquimarina DSM 16071)
MQFQCNDATIENTLLSHKKLEEIIHAQTSIARLGINFGAILNEACLQSQKLTNAAGAVIE
LIEDSEMVIRAATGIASHYLGVRRESANNMSAIAIRTQQALIANDSENDERVDQISRAAI
GHRSMVVFPLFHQKKVVGVLKVLSSKPNFFSMLELKIIAYMSELVASTMFNAQYYAQDEL
FRRATRDELTGISNRALFMDHLHQNIAHAKRDGSKVALIAIDMDNLKVLNDTYGHHIGDK
ALKTLANRFSETIRSSDTVSRFGGDEFAITLSPVNGMDSAKAVVQNLIQSLDLPMKEDGQ
EFQLGASFGIAIFPDDVNTVDELLELADKRMFANKLERKKERQ