Protein Info for B158DRAFT_1121 in Kangiella aquimarina DSM 16071

Annotation: Putative hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 PF19576: Acyltransf_2" amino acids 27 to 244 (218 residues), 100 bits, see alignment E=1.7e-32 PF01553: Acyltransferase" amino acids 71 to 194 (124 residues), 40.8 bits, see alignment E=2.9e-14 PF13444: Acetyltransf_5" amino acids 324 to 421 (98 residues), 85.6 bits, see alignment E=5.2e-28

Best Hits

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_1867)

Predicted SEED Role

"Putative hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>B158DRAFT_1121 Putative hemolysin (Kangiella aquimarina DSM 16071)
MIDSKNLVEQLLPQLDKSPRIKSGISNLIAKLFHQQEINHFIEQHQHLSHSDFLEKVNEH
LGLSYTVSNSSLENIPVSGRVVIIANHPLGSLDGLALLALVHSVRKDVKIVVNELLGSMT
PLRPFFLGVNNLIGQNSRYKIQQLHQALDDEQAVIFFPAGEVSRLSVKGVRDGKWHSGFL
RMAKHAKAPVLPIHVGGKNSKFFYGLSLIAKPVSALLLVREMFKNVSLTLPIKVGNLIPF
ASFSGMSPASKDSILRFKEHLYGLKKNKSELFETEQSIAHPEKKQLLKEELSRCRLIGQT
HDNKKIYLLENTIDSVLLREIGRLREVAFRKVGEGTGNRRDIDKFDYYYKHIVLWDEQNL
EIVGSYRIADISKFQEDQELYSETLFGYEDQLRQKFPMAMELGRSFVQPHYWGKRSLDYL
WFGIGAYLRENPHVRYLFGSISLSNDYPTFAKDLIIYFYQKFYGAPLLLARSFNAYRIKP
VQKAKLEKLFNHLDEKEAFSVLKSELAKLGCSVPTLFKQYSDLCIEGGVEFHDFGSDPAF
GDCIDSVVWIDLLKLKDKKRKRYID