Protein Info for B158DRAFT_1088 in Kangiella aquimarina DSM 16071

Annotation: Beta-barrel assembly machine subunit BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 823 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 26 to 823 (798 residues), 750.9 bits, see alignment E=8.3e-230 PF07244: POTRA" amino acids 94 to 174 (81 residues), 43.8 bits, see alignment E=5.3e-15 amino acids 178 to 265 (88 residues), 54.5 bits, see alignment E=2.3e-18 amino acids 268 to 345 (78 residues), 41.6 bits, see alignment E=2.5e-14 amino acids 349 to 423 (75 residues), 47.1 bits, see alignment E=4.9e-16 PF01103: Omp85" amino acids 450 to 823 (374 residues), 251.9 bits, see alignment E=1.8e-78

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 84% identity to kko:Kkor_1904)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (823 amino acids)

>B158DRAFT_1088 Beta-barrel assembly machine subunit BamA (Kangiella aquimarina DSM 16071)
MRLITKTVTALVLSALFSKAGAIEPFVVEDIQVEGLQRVELGSFFTELPIRVGETLDDAR
VPGIIRAIHQSGNFDFVKLEKEGNTLKAIVVERPVITDIIIKGNKVLKTEQLLEGMEGAG
ISKGEVLNSFVLEKIEQEIANQYYSNGHYHISVEKKLAELSRNRVQLHLTINEGGSAKIK
EFNIIGNNVFPDNKLLSQFELTTGGFLTFITDDNKYSSTTLEKDLETLTSFYKDRGYLQF
KITSTEISLANNEEDIYITIVVDEGEVYTISELDVLGDFNFDVETFKNLIPLKAGDTYSA
AAMTFAEEQIKQFLGLYGYAFAEVRTIPELSKDTPEAKLRVFINTGERYYVDRIGFKGNT
STDENVLRREVRVQEGGSLSSALVERSKIRLQRLPYLESVKVDTVKKEGSTDRADVIFEV
QERSAAQVSGGLGYNDFYGMSINGELSHSNFMGTGNSVGLALNTNKAIKSIRLNYTDNYF
TQDGIGLSSNINFSETDYGKLNLIAQSLDTIGFGTNVFLPTGEFSTFNVGFNVSKNELSS
PITNSQRVIDFFELLGSDARVDTDVEFDIFSVNLGYSINSLNRAIFPSKGTRHRYGLDVG
TSIGDLEFYKATYDYDYYFPISNDGWIFSIRGGLAYGDGYGDTEDLPYFQNFYGGGSSSL
RGFETNTIGPRDIQRIRTTQSVPSPIPGAGNTTVILPSEYDQLFIGRYSVGGNARFLNSF
ELIFPTPFIEDNSNVRTSFFVDVGNVWDTKFDAERFEGLNIEQNSLLQFVPDYSDYKDYR
ASYGISLQWYSAMGPLQFSLSRPLKSEPYDDTETFSFTIGRTF