Protein Info for B158DRAFT_1080 in Kangiella aquimarina DSM 16071

Annotation: ribosomal protein S2, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01011: ribosomal protein uS2
  • amino acids 4 to 226 (223 residues), 350.8 bits, E=1.3e-109
• PF00318: Ribosomal_S2
  • amino acids 9 to 224 (216 residues), 325.6 bits, E=5.6e-102

Best Hits

Swiss-Prot: 71% identical to RS2_PSEA6: 30S ribosomal protein S2 (rpsB) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 98% identity to kko:Kkor_1912)

MetaCyc: 73% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Protein Sequence (244 amino acids)

>B158DRAFT_1080 ribosomal protein S2, bacterial type (Kangiella aquimarina DSM 16071)
MSKVSMRDMLQAGVHFGHKTRFWNPQMRPYIFGARNKIHIINLEETVPMFNDALNYLGKI
ASNKGKILFVGTKRAASDIVKEEATRCGQFFVDKRWLGGMLTNYKTIRGSINRLKDLEKQ
SEDGTFERLTKKEALMRRREMEKLEASIGGIKNMGGLPDVLFVIDADHENIAIAEANKMG
IPVVAVVDTNSSPKGVDYIIPGNDDAIRAIRLYCAAVADAVLDGKQSSATTADQSDEFVE
AEEA