Protein Info for B158DRAFT_1066 in Kangiella aquimarina DSM 16071

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 123 to 155 (33 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 380 to 397 (18 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 443 to 462 (20 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 15 to 457 (443 residues), 201.1 bits, see alignment E=3.7e-63 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 32 to 460 (429 residues), 279.6 bits, see alignment E=2.1e-87 PF03600: CitMHS" amino acids 45 to 404 (360 residues), 194.7 bits, see alignment E=2.3e-61

Best Hits

KEGG orthology group: K14445, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5 (inferred from 91% identity to kko:Kkor_1927)

Predicted SEED Role

"Probable transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>B158DRAFT_1066 anion transporter (Kangiella aquimarina DSM 16071)
MQQQLRPIALFFGPALAALVYFLMSSSGFTHPASITAAIASLCAIWWIFEPIPIPATSLI
PIAAFPAFDVLSAKQVAEAYGHWLILLLMGGFILSTALEKSGTHKRLALGMIRLVGSHSE
KRIVFGFMVASAALSMWISNTATTLMLLPVAMAIIQCGPDNENTRKFAIALLLGLGYAAN
IGGVGTPIGTPPNLLFMNFYAQATGEVISFIDWMMWALPIVILFVPLMWLWLTRKLKAHQ
SYDLPPVGKWRPEEKRTMAVFTVVALLWISRTGPFGGWSELLGLEHANDASVALLGVIAM
FMIPNGKGCKLLDWETANRIPWGVLLLFAGGIAIASAFTASGLSEIIGNSMGFLTSLPPL
LLIVSICLIVTFITELTSNTATAALLMPILAAAGVAADMDPAILMFPAAISASCAFMLPV
ATGPNAVIFSSNKLSVELMVRNGFILNLIGAGIITLVVYFLVGH