Protein Info for B158DRAFT_1061 in Kangiella aquimarina DSM 16071

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 9 to 266 (258 residues), 318.6 bits, see alignment E=1.3e-99 PF00753: Lactamase_B" amino acids 19 to 178 (160 residues), 74.8 bits, see alignment E=9.2e-25 PF16123: HAGH_C" amino acids 179 to 266 (88 residues), 97 bits, see alignment E=7e-32

Best Hits

Swiss-Prot: 44% identical to GLO2_NITEC: Hydroxyacylglutathione hydrolase (gloB) from Nitrosomonas eutropha (strain DSM 101675 / C91)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 80% identity to kko:Kkor_1932)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>B158DRAFT_1061 hydroxyacylglutathione hydrolase (Kangiella aquimarina DSM 16071)
MNSSKPVRIIPLKAFSDNYIWVIFSPDGKQVSVVDPGDSRPVIEFLEDNNLKLNSILITH
YHNDHIGGVQKLKDRYHCHVYASRHDKLRFTDTELDEGDQISLFDNTYQFSVLHLPGHTM
GHIGYFGQNLDGQNLIFCGDTLFRAGCGRMFEGTPEIFYNTLQKLAQLPANTLVYCTHEY
TLANIAFAKTVEPDNSELLALEEKCQQLREKDLETLPSTIESELNTNPFLRCSKATVIQA
AEKATHKSLSDPVETFATIRRLKDNF