Protein Info for B158DRAFT_1060 in Kangiella aquimarina DSM 16071

Annotation: FOG: LysM repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01464: SLT" amino acids 116 to 222 (107 residues), 86.1 bits, see alignment E=1.3e-28 PF01476: LysM" amino acids 342 to 384 (43 residues), 57.6 bits, see alignment 1e-19 amino acids 412 to 455 (44 residues), 54.9 bits, see alignment 6.9e-19 amino acids 469 to 511 (43 residues), 57.8 bits, see alignment 8.2e-20

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 91% identity to kko:Kkor_1933)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>B158DRAFT_1060 FOG: LysM repeat (Kangiella aquimarina DSM 16071)
MKRLLLISCLGLTACSTLVKQEDTVNDPRFDNPQTTEDGSPLPAPELDNNNPLLLSDSEV
APFVPNLWEHLASEQSFANVQHPRIDAFREQYLKSPHLLLKRADKAAPYLYYIITELENR
NMPVELAFTPMVESNFDPLAHSVVQAAGMWQFMPKTAKGFGITIDEWYDGRRDIVASTHA
ALDYYQYLNKMFDGDWLLTVAAYNVGPGNVMKAIRANKRQGKPTDYWSLKLPKETMRHIP
KWLALSDIFLNAPKYQVDLPLIDNQPAFVEVEVDAPANLMELAKIAQIDKDTFYRLNPAY
NRLFVPEHHKKATILVPVETVDHFNQGLLEIDPKQLMASVSYKVKSGDNLSLIAKRHNTS
VKTIKQLNGLKSDFLKIGQELKMPGIINATEYEKNFFATLSKNQQRRRYQVYNVRSGDSL
WTIAKKFGVSTRQLANWNGIAQNSTIRIGQKLKVWPRGYANYASNKSSYQVKSGDSLYTI
ARRFNVKVSDLTKWNGLKNASLIKPGQTLTIYSK