Protein Info for B158DRAFT_1051 in Kangiella aquimarina DSM 16071

Annotation: outer membrane transport energization protein ExbB (TC 2.C.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 50 to 158 (109 residues), 77.7 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 95% identity to kko:Kkor_1942)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>B158DRAFT_1051 outer membrane transport energization protein ExbB (TC 2.C.1.1.1) (Kangiella aquimarina DSM 16071)
MELIYTILDFIDKGGWVLWWIGLVLFLMWTFIIERYWYIYSQFPKEARMMVAQWNAREDT
KSWRAHRIREAWVSIAREALNQRMLLIKTLIAICPLLGLLGTVTGMIDVFESMSGQGSGS
ARQMAGGIFKATIPTMAGMVSALSGIFFSSRLEQTAYIKSHQLADNLPHH