Protein Info for B158DRAFT_1020 in Kangiella aquimarina DSM 16071

Annotation: UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 2 to 198 (197 residues), 54.3 bits, E=2.4e-18
• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 4 to 230 (227 residues), 278.6 bits, E=1.7e-87

Best Hits

Swiss-Prot: 45% identical to LPXH_CHRSD: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 94% identity to kko:Kkor_1967)

MetaCyc: 44% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (14/25 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Protein Sequence (238 amino acids)

>B158DRAFT_1020 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (Kangiella aquimarina DSM 16071)
MIHIISDLHLCEERPDLTALFNQYMDEIAPKSDALYVLGDLFESWIGDDDDSEFVKSIIA
KFKDYSETGKPLYFQHGNRDFLLGDEFAKATGGVIVGEVHPITIGNKEAILMHGDSLCWD
DKEYMQFRQMVRSDEWQQQLLSQPLAVRRGIAADLRQKSREAQANKASAITDVHPDAVKE
VLQKHQADILIHGHTHRPDFHDIEVNGKHCQRIVLSDWGDKGHFLTIEGDEIDSHYFA