Protein Info for B158DRAFT_0991 in Kangiella aquimarina DSM 16071

Annotation: ABC-type multidrug transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00005: ABC_tran" amino acids 20 to 157 (138 residues), 80.8 bits, see alignment E=1.6e-26 PF13304: AAA_21" amino acids 129 to 192 (64 residues), 28.5 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 97% identity to kko:Kkor_1995)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>B158DRAFT_0991 ABC-type multidrug transport system, ATPase component (Kangiella aquimarina DSM 16071)
MSNIIEAKGLNKQYGNFKALDNVSFELESGRILGLIGPNGAGKTTLLKSLLGLTPFEGEL
NIFGLDPHKQRDELMKRVCFIADVAVLPRWIKVSQAIDFVEGVHPRFSRELCEKYLEQTK
IKRNSRVKSLSKGMVVQLHLALIMAIDADLLILDEPTLGLDILFRKSFYEQLLNDYFDDN
RTIIITTHQVEEIEHILSDLIFIQDGKIVLDDSMDAIADSYFEVMVEKEFEEAALAMKPL
NVREVFGQKVCLFSGIAKEQLQELGKVRKPSVADLFVAKMKGEAA