Protein Info for B158DRAFT_0989 in Kangiella aquimarina DSM 16071

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 24 to 53 (30 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 41 to 307 (267 residues), 159 bits, see alignment E=6.9e-51

Best Hits

Swiss-Prot: 43% identical to Y4970_PHOPR: UPF0324 membrane protein PBPRB0970 (PBPRB0970) from Photobacterium profundum (strain SS9)

KEGG orthology group: None (inferred from 89% identity to kko:Kkor_1997)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>B158DRAFT_0989 Predicted membrane protein (Kangiella aquimarina DSM 16071)
MPYVFQLIINVQNSKLFPFTPANIVLLVLSLACVFSLLPASYALAAGLIWGWFFADQQAL
PLSSWASLLLKIAIVLLGFSLPLGELWGTARDSFVLTVSVIAGALLLGLLIAKLLKLNNQ
QGWLISSGTAICGGSAIAAVGSSIKANSQNMVISLAIVFILNAVALFVFPAVGHWLELSQ
SQFGLWAALGIHDTSSVVGAAAVYGEEALEVATTTKLSRALWIIPLAIVASISQHSGKIK
FSLPLFIVFFLLASAISSFLLSSELMAQVGTYIKPASKNLFALSLLWMGTSLNRTAIKSI
PFRSMLLGVILWLAVSISSLYVVMQWYS