Protein Info for B158DRAFT_0978 in Kangiella aquimarina DSM 16071

Annotation: DNA topoisomerase IV, B subunit, proteobacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 TIGR01055: DNA topoisomerase IV, B subunit" amino acids 5 to 626 (622 residues), 1038.8 bits, see alignment E=0 PF02518: HATPase_c" amino acids 29 to 150 (122 residues), 53.8 bits, see alignment E=4.9e-18 PF00204: DNA_gyraseB" amino acids 219 to 385 (167 residues), 141.5 bits, see alignment E=4e-45 PF01751: Toprim" amino acids 414 to 523 (110 residues), 47.1 bits, see alignment E=4.6e-16 PF00986: DNA_gyraseB_C" amino acids 559 to 621 (63 residues), 82.5 bits, see alignment E=3.9e-27

Best Hits

Swiss-Prot: 77% identical to PARE_PSEAE: DNA topoisomerase 4 subunit B (parE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 98% identity to kko:Kkor_2008)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>B158DRAFT_0978 DNA topoisomerase IV, B subunit, proteobacterial (Kangiella aquimarina DSM 16071)
MANNQYTAESIEVLSGLDPVKKRPGMYTDTSRPNHLGQEVIDNSVDEALAGHAKTIKVIL
HKDGALEVEDDGRGMPVDIHPEEGIPGVELIMSKLHAGGKFSNKNYQFSGGLHGVGISVV
NALSKRVEVTVKRDGNQYFMAFEDGFKVKDLEVVGEVGKRNTGTSVKFWPDSKYFDSEKF
SVSRLKHLLKAKAILCPGLKVVFDNKAGGEQDEWLYEDGLTAYLLEQAGGFEKLPDEPFT
GSLQGEAEAVDWAFMWLPEGGECLAESYVNLIPTPQGGTHVNGLRNGLLEAMREFCEFRN
LLPRGVKLSAEDVWDRISYVLSVKLDDPQFSGQTKERLSSRQCATFVAGVVKDAFSLWLN
QNPVIGDALAERAISNAHKRMRASKKVVRKKVTQGPALPGKLADCAGTDSASSELFLVEG
DSAGGSAKQARDKEYQAIMPLRGKILNTWEVDSNQILASQEVHDISVAIGLDPNSDDLSK
LRYGKICILADADSDGLHIATLLCALFVRHFRPLVRAGHVFVAMPPLYRIDVGKEVFYAL
DEDEKQGLLDRIKAENKRGKIQVQRFKGLGEMNPKQLRETTMARETRRLVQLTLGGDGEA
EQIMDMLLSKKRASDRKEWLELKGNKAEI