Protein Info for B158DRAFT_0974 in Kangiella aquimarina DSM 16071

Annotation: Protein-L-isoaspartate carboxylmethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF01135: PCMT" amino acids 13 to 204 (192 residues), 124.1 bits, see alignment E=1.8e-39 PF13847: Methyltransf_31" amino acids 83 to 157 (75 residues), 51.6 bits, see alignment E=2.3e-17 PF13649: Methyltransf_25" amino acids 86 to 162 (77 residues), 47 bits, see alignment E=8.9e-16 PF08242: Methyltransf_12" amino acids 87 to 161 (75 residues), 35.7 bits, see alignment E=3e-12 PF08241: Methyltransf_11" amino acids 87 to 161 (75 residues), 34.4 bits, see alignment E=7.3e-12

Best Hits

Swiss-Prot: 38% identical to PIMT_DICT6: Protein-L-isoaspartate O-methyltransferase (pcm) from Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 92% identity to kko:Kkor_2012)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>B158DRAFT_0974 Protein-L-isoaspartate carboxylmethyltransferase (Kangiella aquimarina DSM 16071)
MEQQLLDLEQARHNMVEQQIRPWNVLDNQLLDLISGLPRDRFVPDEYRSLAYADTQIPIG
HSQCMMPPREEARMLQALRIQPSDVVLEIGTGTGYCTALLAQLAYKVYSVDIIGEFIEQA
KERTQQLGLDNIEFEEGDAASGWPHYKPYDVIAITGSFYKLPKAYKRHLPIGGRLFCIVG
QEPAMKAKLITRTGDDEWHEEVLYETVLPYLINAKRAEQFEF