Protein Info for B158DRAFT_0965 in Kangiella aquimarina DSM 16071

Annotation: Serine/threonine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF13672: PP2C_2" amino acids 20 to 201 (182 residues), 37.6 bits, see alignment E=1.8e-13 PF00481: PP2C" amino acids 59 to 134 (76 residues), 32.1 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K01090, protein phosphatase [EC: 3.1.3.16] (inferred from 93% identity to kko:Kkor_2021)

Predicted SEED Role

"protein phosphatase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>B158DRAFT_0965 Serine/threonine protein phosphatase (Kangiella aquimarina DSM 16071)
MSSLQTSKIQFAMLSHKGMSRQNNDDKVFASSDLGLWVLSDGVGGLKQGEQASQYAIDEI
SKSISKGFNLHNAVHSAHSVIKAHNRHEQEDRGATVVAVHSNGADYEIAWVGDSRAYLWN
QETGELTQLTEDHTLVQKLVNAGLLEQTEVKNHPKRHVITQCLGIENETPLSIGSLKREW
DYGESLLLASDGLYEELSRQEIIAALKLPRDNQAKVEYLVELACKNGGSDNISLMLISSP
VTEPKPQKQETPVEKFIKKIKTILKLG