Protein Info for B158DRAFT_0962 in Kangiella aquimarina DSM 16071

Annotation: Restriction endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF03235: DUF262" amino acids 34 to 154 (121 residues), 62.3 bits, see alignment E=1.1e-20 PF01844: HNH" amino acids 316 to 359 (44 residues), 50.7 bits, see alignment 2.3e-17 PF14279: HNH_5" amino acids 316 to 358 (43 residues), 31.2 bits, see alignment 2.4e-11

Best Hits

KEGG orthology group: None (inferred from 71% identity to cpb:Cphamn1_1158)

Predicted SEED Role

"HNH endonuclease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>B158DRAFT_0962 Restriction endonuclease (Kangiella aquimarina DSM 16071)
MKIELKEITVRELTEGFEDNEEAGVVGYGGKLDIRPPYQREFIYKDKQRDAVIHTLTRDF
PLNVMYWAVREDGGYEVIDGQQRTLSICQYVNGDFAYMFKYFHNLKDDEKEQILNYKLMV
YICSGTDSEKLDWFKTINIAGEKLTEQELRNAVYSGTWVTDAKRYFSKNGCPAFQIGSDY
LVGTPIRQDYLETAIKWISKGNIEVYMSKHQHDPNALALWQYFQNVITWVQGTFTKKRTK
FMKGVDWGELYNKFKDEVYDTKKLENEVAMLIADDDVEKKKGIYPYVLTRDEKHLGIRAF
SDSMKQKVYEKQKGICTSCKEHFEISEMEGDHITPWHEGGKTIESNCQMLCKDCNRRKSG
K