Protein Info for B158DRAFT_0927 in Kangiella aquimarina DSM 16071

Annotation: VCBS repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF17963: Big_9" amino acids 38 to 115 (78 residues), 61.7 bits, see alignment E=1.4e-20 PF17803: Cadherin_4" amino acids 38 to 95 (58 residues), 45 bits, see alignment E=1.9e-15 PF17892: Cadherin_5" amino acids 40 to 128 (89 residues), 46.9 bits, see alignment E=3.1e-16 TIGR01965: VCBS repeat" amino acids 59 to 102 (44 residues), 21.8 bits, see alignment E=8.3e-09

Best Hits

KEGG orthology group: None (inferred from 78% identity to kko:Kkor_2059)

Predicted SEED Role

"putative calcium-binding outer membrane-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>B158DRAFT_0927 VCBS repeat (Kangiella aquimarina DSM 16071)
MNTAKYTSSIPLIGIFILSVLLLSACGDDGPYSAFEPPMNTKPEAVSQSVITETDTTVTG
QLEGTDADGDTLTFSVSEDVMYGVLTVNSDGSFSYTPDNGYTGSDQFSFVVSDGSATSDP
AVVDITINVKQELFSSYSRASYSKAATDEPTGVNGREFIFDVDTTDYYQDLVIEGEQ