Protein Info for B158DRAFT_0914 in Kangiella aquimarina DSM 16071

Annotation: Dipeptidyl aminopeptidases/acylaminoacyl-peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00930: DPPIV_N" amino acids 360 to 519 (160 residues), 64.9 bits, see alignment E=1.7e-21 PF02129: Peptidase_S15" amino acids 565 to 709 (145 residues), 38.8 bits, see alignment E=2.7e-13 PF20434: BD-FAE" amino acids 578 to 686 (109 residues), 37 bits, see alignment E=7.9e-13 PF00326: Peptidase_S9" amino acids 613 to 810 (198 residues), 154.1 bits, see alignment E=1.2e-48 PF01738: DLH" amino acids 614 to 793 (180 residues), 22.5 bits, see alignment E=2.3e-08

Best Hits

KEGG orthology group: None (inferred from 85% identity to kko:Kkor_2073)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (810 amino acids)

>B158DRAFT_0914 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases (Kangiella aquimarina DSM 16071)
MKKQLIPQRLVQSLLGCALLVSTTVSTAASAAIQAQPLTLNKVMSDPDWIGNAPQNAYWH
SDGQSIYYQQKLVGNKEKAWYQLDLASKQAKKLSDKELLERDGSNGVLSQNKLLKAYNLN
GDLYVRYLETGEVRQLTKTLENEGTPIFIGNQSVAYRQGNSFYSINLNDGLISHLVDVRL
EENPDKEQDKSFLDQQQTRYFDYIRQKQEQREHDKKRKQQIAESSDRDAPQPWYLGKDKE
IRTLSLSPNGRYVVVGTYDKSDKSGKSDNMPRFVTEDGYVENQEVRALVGTYEPRHETLH
LLDLKNREQYELSYEDLPYIEDDPLADIKRDTARRQDKKYQAHEGIRNVSIFNWGSDRGV
QWSPDGNNALFMLFSADNKDRWIATIDFDDKELENQHHMRDKAWINDWNFNDFGWINNKS
IYYTSEESGFSHLYTKTLNRSADALTKGRYVVDSVNLSPDNKFFYYRANKKHPGIFEVYR
VAVGGGESQAVTNLGGLNDYTVSPDGSQLIIEHSEATKPKDLYLVSSKGGDATQLTDTVS
DEFKSVNWTQPEYVEIPSRDVDMPIHARLYKPADFDAERAEQYPAVIFIHGAGYLQNAHQ
GWSLYFREFMFHSFLTQQGYVVLDIDYRGSANYGRDWRTAIYRRMGTPEVVDLQDGANWM
ASNVNVDRSKVGIYGGSYGGFLTFMGLFTAPDEFAAGASLRPVTDWAHYNHGYTSNILNT
PEVDPVAYERSSPIEFAEGLNKPLLIAHGMVDDNVFFKDTVRLVQRLIELEKTEYFETAI
YPIEPHGFTEPSSWLDEYKRIYYLFERHLK