Protein Info for B158DRAFT_0912 in Kangiella aquimarina DSM 16071

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 193 to 214 (22 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 367 to 393 (27 residues), see Phobius details PF13364: BetaGal_ABD2" amino acids 82 to 163 (82 residues), 22.5 bits, see alignment E=1.6e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 401 to 562 (162 residues), 117.7 bits, see alignment E=2.1e-38 PF00990: GGDEF" amino acids 403 to 559 (157 residues), 116.3 bits, see alignment E=1.2e-37

Best Hits

KEGG orthology group: None (inferred from 81% identity to kko:Kkor_2075)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>B158DRAFT_0912 diguanylate cyclase (GGDEF) domain (Kangiella aquimarina DSM 16071)
MIRLLFVFFLLLFGALQSQAVTVVESSSIKDTSNTRFDIEQIPYVLKGEWQICLYSPPKT
SHYDCRTISVPDSIETAFPGLDGFVFYRTQFSISRQLEHQALAIYIPQIRDADKLYINGH
LIGETGQFAPNFEKATLYQRRYPVPSSILKFDQNNELIIKVYNHARPGGLVMGAPVIDSV
KNIYQQTATQESMLMIFIGMILLISAVQIFYYLAQPEHRENLLFAILCVFESIYLLTYSQ
AALDSGINLTSIFRINMMLFAILTVNFFLFVSSFFKQGIPWIIKGILTIILLLGTVSVTI
LPIDWIYYVLHIIQLISVFILVPYYFYIFYRAKRQELPYASLMTKVLALYIFTVLIDFAI
DQQWLPLFVTGIAGLLSPIFLITVFIAITFILIHKHWLYYRHATYDYLTNCLRRSSFEQR
LAEEIHRIHRTGQSIVVALIDIDNFKQINDAHNHLVGDQVLQAVVNRTRASLRDFDLLGR
YGGDEFIVAAEVSDKKDATQLLKRIHKNITSHAVIDKNDKAIDVSITIGAVVAEASDLVT
ALQMIEQADDILVSGKVKQKGHIHI