Protein Info for B158DRAFT_0907 in Kangiella aquimarina DSM 16071

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 375 to 399 (25 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details PF05684: DUF819" amino acids 21 to 431 (411 residues), 289.3 bits, see alignment E=2.4e-90

Best Hits

KEGG orthology group: None (inferred from 85% identity to kko:Kkor_2082)

Predicted SEED Role

"DUF819 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>B158DRAFT_0907 Predicted integral membrane protein (Kangiella aquimarina DSM 16071)
MAVTETTEKVALIQSDAVTFGLIMAVLGLIFYTASRGDGFWHKFYKHIPALLLCYFIPGA
LNTLGFFEKSSADNIYHIASRYLLPASLFLLTLSIDFKKIFGLGWRAVAMFFAGTVGVII
GGPLAVLLFAFVAPEWVGITDQAVPKGEEIWAGLATVAGSWIGGGANQASMQVLYEVSDT
LFGTMAVMDVLVAEIWMVALLFMIKKSDSIDKWMKADNSSIEELKVTVEKYTRENERIAS
FEDYKMILGLAFAVVGVAHLAGIYFPEWILGSVEKGSTAYKVFDNIGFGSAFFWIIIAST
VLALIMSQTKLRQIEHAGSTKIGTVFIYILVASIGMKMDLTKIFDHYQVFFIGLVWMMIH
VIILFVVAKLIKAPYFFIAVGSKANIGGAASAPVVAAAFHPSLAPVGVLLAILGYAVGSV
GAIATAIMMRAVVGG